Skip to content
  • Reliable Manufacturers and distributors
  • Login
  • Reliable Manufacturers and distributors
LumeenLumeen
  • Home
  • Shop
  • Guarantee
  • Reviews
  • Shipping
  • FAQs
  • Blog
  • About Us
  • Contact Us
  • Cart / $0.00 0
    • No products in the cart.

      Return to shop

  • 0
    Cart
Buy B7-33 Peptide | Relaxin Mimetic for RXFP1 Research – High Purity
Buy B7-33 Peptide | Relaxin Mimetic for RXFP1 Research – High Purity
Home / Peptides for Sale

B7-33 Peptide

  • Buy Bacteriostatic Water | 0.9% BAC Water for Peptide Reconstitution
  • Buy ARA-290 Peptide | Cibinetide Innate Repair Receptor Agonist

$50.00

Buy B7-33 peptide, a potent single-chain relaxin mimetic and RXFP1 agonist for cardiovascular and anti-fibrotic research. High purity. Shop now with COA.

Categories: Buy Peptides Online, Peptides, Peptides for Sale, Purchase Research Peptides, Wholesale Peptides Tags: Anti-Fibrotic Peptides, B7-33 1mg, B7-33 5mg, B7-33 95% Purity, B7-33 Anti-Fibrotic Peptide, B7-33 Bulk Order, B7-33 Cardioprotective Research, B7-33 CAS 1818415-56-3, B7-33 COA, B7-33 Cost, B7-33 Fibrosis Studies, B7-33 for Sale, B7-33 in Stock, B7-33 Lab Supply, B7-33 Peptide USA, B7-33 Price, B7-33 Relaxin Mimetic, B7-33 Research Chemical, B7-33 Research Peptide, B7-33 RXFP1 Agonist, B7-33 Supplier USA, B7-33 Vial, B7-33 Wholesale, Best Peptide Supplier, Bulk Peptide APIs, Buy B7-33, Buy BPC-157, Buy CJC-1295, Buy GHK-Cu, Buy Peptides Online, Buy Research Peptides, Buy Semaglutide, Buy TB-500, Buy Tirzepatide, Cardiovascular Research Peptides, Custom Peptide Synthesis, GMP Peptides, High Purity B7-33, High Purity Peptides, Order B7-33 Online, Peptide Blends, Peptide Manufacturer, Peptide Raw Material, Peptide Source, peptide supplier USA, Peptide Vials, Peptides for Sale, Purchase B7-33, Relaxin Peptide Analogue, Research Peptides USA, RXFP1 Agonist Peptide, Wholesale Peptides
  • Buy Bacteriostatic Water | 0.9% BAC Water for Peptide Reconstitution
  • Buy ARA-290 Peptide | Cibinetide Innate Repair Receptor Agonist
  • Description
  • Reviews (0)

B7-33 Peptide – Advanced Relaxin Mimetic for Cardiovascular & Anti-Fibrotic Research

B7-33 Peptide (Relaxin Mimetic) – RXFP1 Agonist Research Compound

B7-33 is a synthetic single-chain peptide analogue of human relaxin-2 (H2 relaxin), developed as a minimal potent derivative of the native peptide hormone . Unlike native H2 relaxin, which features a complex two-chain, three-disulfide-bond structure that is difficult and costly to synthesize, B7-33 maintains the organ-protective effects of relaxin in a simplified format . It functions as a selective agonist of the Relaxin Family Peptide Receptor 1 (RXFP1), preferentially activating the pERK signaling pathway over cAMP in cells natively expressing RXFP1 . This research-grade peptide is strictly for laboratory investigation and is not intended for human consumption.

Key Factual Details

Attribute Detail
Chemical Name B7-33 Peptide (Relaxin B-chain-only analogue)
Sequence Val-Ile-Lys-Leu-Ser-Gly-Arg-Glu-Leu-Val-Arg-Ala-Gln-Ile-Ala-Ile-Ser-Gly-Met-Ser-Thr-Trp-Ser-Lys-Arg-Ser-Leu-NH₂ 
Sequence Shortening VIKLSGRELVRAQIAISGMSTWSKRSL-NH₂ 
Molecular Formula C₁₃₁H₂₂₉N₄₁O₃₆S 
Molecular Weight ~2,986.54 g/mol 
CAS Number 1818415-56-3 
Purity ≥95% (HPLC verified) 
Classification Relaxin mimetic / RXFP1 receptor agonist / Anti-fibrotic peptide

Mechanism of Action & Research Applications

Selective RXFP1 Receptor Agonist: B7-33 binds to RXFP1, which is the primary receptor for human relaxin-2, and preferentially activates the pERK pathway without inducing significant cAMP signaling activation . This biased agonism replicates the beneficial effects of native relaxin while potentially avoiding pathways associated with tumorigenesis .

Anti-Fibrotic Activity: The peptide significantly modulates profibrotic gene expression, showing greater downregulation of Collagen Type I α-1 Chain (COL1A1) than reference anti-fibrotic agents, while maintaining biocompatibility with normal fibroblasts .

Cardioprotective Effects: B7-33 equivalently reduces left ventricular fibrosis, normalizes inflammation and cardiomyocyte hypertrophy, and restores blood vessel density and aortic contractility in experimental models of cardiomyopathy, matching the protective effects of native relaxin .

Research Applications:

  • Cardiovascular Research: Investigating heart failure, myocardial infarction, and vascular dysfunction 

  • Fibrosis Research: Exploring hypertrophic scar management, organ fibrosis, and TGF-β/Smad pathway modulation 

  • Preeclampsia Models: Evaluating therapeutic potential in hypertensive pregnancy disorders 

  • Drug Delivery Systems: Investigating electrospun peptide-based dressings and controlled release formulations 

Research Parameters

All dosages are for in-vitro and preclinical research use only and are not intended for human consumption.

In Vitro Research Concentrations :

  • Fibroblast viability studies: 0.03–0.3 μg/mL (72-hour exposure) 

  • Gene expression modulation: 298.7 ng/mL 

  • Controlled release dressings: 1.5% w/w loading 

Preclinical Animal Dosing :

  • Cardiomyopathy model (mouse): 0.25 mg/kg/day, subcutaneous 

  • Preeclampsia model (rat): 35 μg, intraperitoneal biweekly from gestation day 10-20 

  • RUPP model (rat): Twice weekly intravenous from gestation day 10-20 

Storage:

  • Store lyophilized powder at -20°C

  • Protect from light and moisture

Order B7-33 Today – Request a quote for your cardiovascular or anti-fibrotic research project. Available in various pack sizes with Certificate of Analysis. Contact our sales team for bulk pricing and custom synthesis inquiries.

Reviews

There are no reviews yet.

Be the first to review “B7-33 Peptide” Cancel reply

Related products

Buy ABP-7 Peptide

Buy Peptides Online

ABP-7 Peptide

$50.00 – $80.00Price range: $50.00 through $80.00
Select options
This product has multiple variants. The options may be chosen on the product page
CJC-1295 & Ipamorelin Blend (10mg)

Peptides

CJC-1295 & Ipamorelin Blend (10mg)

$60.00
Add to cart
Buy BPC-157 peptide

Wholesale Peptides

BPC-157 5mg/10mg

$50.00 – $80.00Price range: $50.00 through $80.00
Select options
This product has multiple variants. The options may be chosen on the product page
GHK-CU

Peptides

GHK-CU

$30.00 – $60.00Price range: $30.00 through $60.00
Select options
This product has multiple variants. The options may be chosen on the product page
CJC-1295 NO DAC (Mod GRF 1-29) (5mg)

Peptides

CJC-1295 NO DAC (Mod GRF 1-29) (5mg)

$70.00 – $125.00Price range: $70.00 through $125.00
Select options
This product has multiple variants. The options may be chosen on the product page
Buy AOD9604 Online USA

Buy Peptides Online

AOD9604

$40.00 – $150.00Price range: $40.00 through $150.00
Select options
This product has multiple variants. The options may be chosen on the product page
Buy Argireline PeptideBuy Argireline Peptide

Buy Peptides Online

Acetyl Hexapeptide-3 (Argireline)

$20.00 – $195.00Price range: $20.00 through $195.00
Select options
This product has multiple variants. The options may be chosen on the product page
Chonluten (20mg)

Peptides

Chonluten (20mg)

$50.00
Add to cart

Lumeen Store is a leading GMP-certified peptide manufacturer founded in 2003. With 20+ years of expertise, we supply high-purity research peptides and peptide APIs to 1,300+ partners across 69 countries worldwide.

Our Commitment:

  • ✅ GMP-Certified Production

  • ✅ ≥98% Purity Guaranteed

  • ✅ Finnrick Verified

  • ✅ 100% Reship on Damage/Loss

  • ✅ 90% Refund on Returns

Useful Links
  • Shop
  • Guarantee
  • Reviews
  • Blog
  • About Us
  • FAQs
  • Shipping & Returns
  • Privacy Policy
Recent Posts
  • Quality Assurance in Peptide Manufacturing
  • Custom Peptide Synthesis: Benefits for Research Organizations
  • What Makes High-Quality Research Peptides Different?
  • Understanding Peptide Manufacturing: From Synthesis to Delivery
  • The Growing Importance of Peptides in Modern Scientific Research
  • How to Choose a Reliable Research Peptide Supplier | Chengdu Kaijie Peptides
Contact Info
Lumeen. – Your Trusted Partner for High-Purity Research Peptides Worldwide.

📍 Company Address: 195 Racetrack Rd Dawson Springs, Kentucky, 42408 Phone Number: +1 (859) 210-9925
📧 Email: support@Lumeen.store
Copyright 2026 © Chengdu Kaijie Biotechnology Co., Ltd.
  • Home
  • Shop
  • Guarantee
  • Reviews
  • Shipping
  • FAQs
  • Blog
  • About Us
  • Contact Us
  • Login
  • Newsletter

Login

Lost your password?

×

No WhatsApp Number Found!

WhatsApp us